SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|152462|fgenesh2_pg.C_sca_1000600 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|152462|fgenesh2_pg.C_sca_1000600
Domain Number 1 Region: 125-308
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.49e-21
Family Fibrinogen C-terminal domain-like 0.00056
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|152462|fgenesh2_pg.C_sca_1000600
Domain Number - Region: 97-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0468
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|152462|fgenesh2_pg.C_sca_1000600
Sequence length 345
Sequence
MLSGVSVDVQIKYKICDNKIIKIWKREKEKEAKSLKMCGILCSRLPWCRAITACPAGTGG
YNCQFHYGVYFAACQSFRSDLNCKIMIETTKNTEPISAEGCANGGIWNGTNCRCLDGFAS
PKCERYIKDCEEGADLGYKNKPGQWDYVTTLTWSTGAPYPFETFCNYNDGKTIMFYRGFG
VPINWNRTWQEYKYVLTETNEAYWMGLENIHYLTNSGTHQLQIYFTRFADSNLFGQFFYK
NFKVGAESTDYQLSYSSLEVVKEPYGLQDGEPDSNTLGPINGSRPFCTWEKPGCSSALQN
GGWWHDAFATQYSLTKPMEPVTVHYHGEDVQVNSISFQVYDNSRS
Download sequence
Identical sequences V4CSS9
XP_009044150.1.39240 jgi|Lotgi1|152462|fgenesh2_pg.C_sca_1000600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]