SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|152842|fgenesh2_pg.C_sca_2000262 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|152842|fgenesh2_pg.C_sca_2000262
Domain Number - Region: 108-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000498
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|152842|fgenesh2_pg.C_sca_2000262
Sequence length 157
Sequence
MVRKLPMLVMTITFTGFLLSFVYGDQWFKMVDCPDFFPGYETSFANLLVSTIYNCVYQAE
KEPTVKSLVFHKDSQTGKKTCYLYAENASSCEGSVGGDSENTYLFKPNDNCGNGGSLTED
KLSCDCNDGYFGPFCTELASVIAHNLLKVVQTLGYCY
Download sequence
Identical sequences V4C7R3
jgi|Lotgi1|152842|fgenesh2_pg.C_sca_2000262 XP_009051599.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]