SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|152863|fgenesh2_pg.C_sca_2000283 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|152863|fgenesh2_pg.C_sca_2000283
Domain Number 1 Region: 136-315
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.09e-30
Family Fibrinogen C-terminal domain-like 0.00011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|152863|fgenesh2_pg.C_sca_2000283
Domain Number - Region: 110-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00524
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|152863|fgenesh2_pg.C_sca_2000283
Sequence length 371
Sequence
MAICSILVMMLTHLTGFILSLECGNQWFMMVDCPNFFPGYNTSFVNMTVNTIYNCVLQAE
KESTAKSLVFHKDSQTGQKTCYLYEEIASSCEGSVEVDFGVNKYLFKPYKCENGGSLTED
KLSCDCIAGYFGISCTELATDCQDLNNRGIRDRGLYSVNLLPNKPPINLTCFGGRTVVMH
QHINKDVNFTFKRSWAEYRDGFYGEENFWLGLELMHILTTQKSQNKLDVSARIVNPGEEQ
EEYLKTTFTGFKVDGENTEFLMGYSGTRYVGNYLGELLRTLNNSRFSTYDRDNDQMAINC
AMKYGGGWWYNNAGTFTRDFTPNEFQFECAPANPTGYFWNQCEGCTSEVKDISTGSVFNG
TVRMVDLVLSD
Download sequence
Identical sequences V4AVA7
XP_009051616.1.39240 jgi|Lotgi1|152863|fgenesh2_pg.C_sca_2000283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]