SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|153045|fgenesh2_pg.C_sca_2000465 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|153045|fgenesh2_pg.C_sca_2000465
Domain Number 1 Region: 280-382,443-504
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-47
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|153045|fgenesh2_pg.C_sca_2000465
Domain Number - Region: 226-268,321-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|153045|fgenesh2_pg.C_sca_2000465
Sequence length 541
Sequence
MVFQLPVAVSLLAWKAIYFLNEKTLPQDNQKMRSCLGGNLYAYELPAPPEIQSITEEEER
NGGQMKESIGLSEIQRGITAKRLTTANGSVPNGQVPNIEAATTNGSTSNLLGSPCHSRSP
SNVSNIVDSMSKSTELFDGFVIGVHRKMILMDVYFLSSQKTRPSLFGTPIIIPCREKTAN
QDLYHFVWAQVARLVSPLPPSEQKTANHAQDCDDSLGYEFPFTLKVVQKDGFTCAKCPWY
RFCRGCKLECNSNLFNNAGSFVAIDWEPTALHLRYQTTQERFYEEHESVEESRRKQTEPI
DLDTCLQAFTKEEELGEDELYYCSKCKKHCLACKKLDIWRLPPVLIINLKRFQFLNGRWV
KSHKIVKFPFKDFDPTHYLAQRPSQTDVKNPRSQSNTSLHSTPANGIVDRNSNTNKSGLH
HNILMNNSFGEMNEVNLDEDEDYKDARYDLYALSCHTGILGGGHYVAYAKNPNKNWYCYN
DSSCKEIQESQVDTNSAYILFYERHNLDYNKFMPDVTGKEPDISEIDDEFESDLKKICVV
Q
Download sequence
Identical sequences V4C897
XP_009051774.1.39240 jgi|Lotgi1|153045|fgenesh2_pg.C_sca_2000465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]