SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|153318|fgenesh2_pg.C_sca_3000221 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|153318|fgenesh2_pg.C_sca_3000221
Domain Number 1 Region: 183-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000128
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 2 Region: 134-190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000101
Family Complement control module/SCR domain 0.0068
Further Details:      
 
Domain Number 3 Region: 261-313
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000188
Family Hairpin loop containing domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|153318|fgenesh2_pg.C_sca_3000221
Sequence length 317
Sequence
MTIAVKILGAIHKFCIADFSTCTDDLPTAQCLTLKNNHECIFDKAVNGTSCLCHETCISS
NLCPAADGPLLDSRCDCIHYLDQCGGYTTPKPGCPLAAWKTDCFRTAYFYDISLSCINNI
QSCSHTVGIPGLQHGGAFRYGDIEQYWCADGYKQIGGSIGLSICWEGNYIQHGDSGEYPV
CELITCSDPPKVLYTNPSATQVSVFDDITYTCQDGTEQIDGGDGRIKCGTDGLWHPCNTT
INPICIGDFAFFVKLPTFSPSVLLITYQSRSSIECASLCLNLYMCVGYTFDSSSSICSLN
ESGDQDDNTQMIQVYPY
Download sequence
Identical sequences V4AFG6
jgi|Lotgi1|153318|fgenesh2_pg.C_sca_3000221 XP_009055467.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]