SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|153600|fgenesh2_pg.C_sca_4000059 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|153600|fgenesh2_pg.C_sca_4000059
Domain Number 1 Region: 75-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000012
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 133-190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000528
Family Complement control module/SCR domain 0.003
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|153600|fgenesh2_pg.C_sca_4000059
Domain Number - Region: 36-77
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0124
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number - Region: 232-289
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.031
Family Pan module (APPLE domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|153600|fgenesh2_pg.C_sca_4000059
Sequence length 310
Sequence
MNTIVCSISLLSVTTLILIDADCAGYPNENNADFHRNEQCSDIVEITCSDGYKMEAAIEC
KSEIQFLWKYKRPVCKLDPKIENGALDTDIASRDIGIEYSYTCNPGFGKYGNEGHVICNE
AGEWEADITCEGQCMSDPEIENGALDTDIASRDIGIEYSYTCNPGFGKYGNDGLVICTEA
REWEANITCEDCFKYYTENTYLTKSPYATPSGRLNQVSCQQSCTNDDRCTASFVSFQSCE
LHGIPAISISHESRAECRTKCVALADCKLMSWNSGSFPICTLFNVTKNNLPSKHQTFSRN
GAFIGENLCK
Download sequence
Identical sequences V4BQJ9
jgi|Lotgi1|153600|fgenesh2_pg.C_sca_4000059 XP_009057875.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]