SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|154253|fgenesh2_pg.C_sca_5000293 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|154253|fgenesh2_pg.C_sca_5000293
Domain Number 1 Region: 134-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000511
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|154253|fgenesh2_pg.C_sca_5000293
Sequence length 191
Sequence
MKFIDIIAGFLLCVLGVCDSKPSIYSIQKRLKNLQSAANKNHEKTMFSMRYTGSDLTSDS
GRGDSVLQSENDKNEYIKKILAQRHSHRPLVKINHQEVADGEGLDEYVVNRLMKEHRQLK
HKRACRGVERRLKTLKCPSDRSICLLDEMVCNDYPDCPNGEDENPAVCLIHDWASRWFSK
IQYYLIPTNDI
Download sequence
Identical sequences V3ZXN6
jgi|Lotgi1|154253|fgenesh2_pg.C_sca_5000293 XP_009060206.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]