SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|154493|fgenesh2_pg.C_sca_5000533 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|154493|fgenesh2_pg.C_sca_5000533
Domain Number 1 Region: 705-827
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000038
Family Cadherin 0.0099
Further Details:      
 
Domain Number 2 Region: 1111-1150,1301-1385
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000339
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 3 Region: 1145-1264
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.046
Further Details:      
 
Domain Number 4 Region: 1554-1629
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000386
Family I set domains 0.039
Further Details:      
 
Domain Number 5 Region: 1635-1684
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000031
Family I set domains 0.034
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|154493|fgenesh2_pg.C_sca_5000533
Domain Number - Region: 431-514
Classification Level Classification E-value
Superfamily Cadherin-like 0.000571
Family Cadherin 0.0076
Further Details:      
 
Domain Number - Region: 1408-1447
Classification Level Classification E-value
Superfamily SEA domain 0.00994
Family SEA domain 0.015
Further Details:      
 
Domain Number - Region: 515-617
Classification Level Classification E-value
Superfamily Cadherin-like 0.0157
Family Cadherin 0.012
Further Details:      
 
Domain Number - Region: 1722-1759
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0366
Family Hormone receptor domain 0.0065
Further Details:      
 
Domain Number - Region: 319-412
Classification Level Classification E-value
Superfamily Cadherin-like 0.0454
Family Cadherin 0.0098
Further Details:      
 
Domain Number - Region: 817-909
Classification Level Classification E-value
Superfamily Cadherin-like 0.0974
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|154493|fgenesh2_pg.C_sca_5000533
Sequence length 1760
Sequence
MAKNIQFSIIALVAALTLISAAPPTCSKEKKIFVSHPKSLQKENGEIYCFYKEGQPKSDV
CEHQSQIVYTSNQKLEYVELQETSFQSCIILTSLDIPVPEICLNYTAKASDENSENPATI
CVVFNPEGPNIPPDQSTLINMADGKKSRIVPIEMSSTDGISDITITDVSPKEFTNYIRVN
SLDPESLNFTITETITTSTDIDVSMMVTDNGNPKLKSMATFRMHVINESITCDDMISIVN
PSDSVGKNVGNASCSSKTGTLNFTITEGGVKFVRMDSVTGSLTLTFTKPSVGVYNLTVTV
QSSSALTIQFKLQIQVGYPPIFTNTPYTLSVNDTTGPGVCFNDIISIDPTTPEKVIYRDI
DNSVIFYFPYSNSTLCTKKDLFSENRKDYNVLYKFDGSNKFGSSESAITITIKVIKQIPV
ITFNTSTELEVSEITVLKTIITTLTIQPQRPVTEVKLTDQANLPFALQVGTPSGYEIIVK
DELDANNTSFYLLSIKASNVDGISTATVNVTIMDNVAPSCEKNLLEPTVNRGVNEGHIVP
VENQCSDVDGDAITFNFTSDTPSYITDHFSIVSNEFRITVKKQLTDLSVQELKSLKFTVD
VSDSFNSQVQIEVNISIFVDAPTCDTNPAITVPETLGEGCVNISAFCNGTDGLRLEYSIP
NFIATTLENGDIQICGDTALEVGTSQIKVVVDDEFNRLEKSTNLTITAVNKHQPVFANVG
GETTIDLSENTTVGSEVFTFTVTDEDDGEFGKFTVTAVMEDFESGIFQVSDNNIILLKKL
NASSTSVYTIFLTATDTGGLNANLTVVINVQDVNEPPVCIQPTTFNISVLMDEGEVGNLP
CYDYDVSSDFKQISYNLIQPQSMSVPMEVDDEGTLKVTGSLLDKPETLEFTVEASTGDQT
TSIKVTVYLSRMFPFLLTKLITSDFPPSCNATSIRTTFKEDSSGCSQEKIRCSNQVSSPM
TLVITNDKTGDLDVQITNDTVEQLDIRVCLSQSGRQNLFTYTIGIRVENELGKVDINWEV
NIEDINDAPYFKENRYTYQLNETTNKQTMVATISVFNEPDPTDPNIQLVDPDTLDKFNIK
HISADGKVMDRVTKQEKAGAVLAISYDDKSFTVTSSLKPELYYQFDVQAEDGGKLTASSI
VTFMVNDVNQAPTCDETNLQKNLSLLQGVSQIFISVDCSDTDFDENFNSLSYSLQTQTTD
VFAISGNGNIYLNKKLPRGTSQHIINIIVKDGGGLTTSSTLTVNVNRDVGAECTPVISPP
NVWLKDECISIESNCVDPTADETSTLSYETTGDYSPDFYVSDGLDGTNVEPSAPELSIGP
VTTNSITILWSYTRPDAVSFIDRHIVEVKTVDSIYTVVQNSVTSYQFNNLQPQAVYSFRV
IAETNNKNLTTIYKHITTRAIPILTNVLIGFKVLNRVWNDKMVNNQSQEYKQLKQETEEN
VRIYFSLSVLYCSQRKIRGDTSYCHIPHEEEERPGSVIFDGIMFVNQSGTVEDTSQTFLD
QVYTGTLGNLTVQDGIVHQGDQYISSATLTLRDGDPDKLLEGTSIEYACKFRLVSVNGVT
KPNVRWFLDDTLLIVTHTPRIKMRNSTDSNDRFGYQYIIQFDKAIPSHAGLLTCMVQSSS
KSSINSSATEAVKIISKPVVTLWPLSTFLQDGDSVTLKCSSPISPVTYSWFDAQTGIEIS
SARNLDSYSVSIVDKDIQVYCKCENLAGMTQSPTATIHHTPSITDSLPCRSSTDARNTTW
PPVKAGTRVKLTCGENYNGI
Download sequence
Identical sequences V3ZE56
XP_009060408.1.39240 jgi|Lotgi1|154493|fgenesh2_pg.C_sca_5000533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]