SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|154773|fgenesh2_pg.C_sca_6000276 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|154773|fgenesh2_pg.C_sca_6000276
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-22
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 2 Region: 146-269
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-20
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|154773|fgenesh2_pg.C_sca_6000276
Domain Number - Region: 292-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000483
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|154773|fgenesh2_pg.C_sca_6000276
Sequence length 490
Sequence
MGDLLKLVRGNGCDQKFSSKDMKSGKISSPNFPAPYAELTTCHYFFESIGDGRIEVEFDY
FELEGLGPGDSTCRFDYIDVFSVDKMGYRTRLNRYCGKKIPPKIISVQPNLEIVFVSDHT
KIASGFSAHFTFLDDSWRPFRPSTPGCGPEILSGWGGVITSPDFPEPFRGGTECTWLIKV
REEQQIIVNIISLDLGQTSETCKDFKLLIYNGFATPDMLPEISMCGQLNDYSSSRRQFLS
HSSRVVIRFVTSQTNVNHGNGFKVSWTAVQMPEDGPCGQFQCGGGKRCIDDMNCEPSPKY
CIHRSLKCDGVPNCGPFDDSDERKCPREIIIMTASIAIPSLAIILLVVLVIYCYRRKRVK
KSTSQEQPLTTSHRQISRDSMAPRGGQLVMHTSFIDVKPVEESDPEIDPDSLPLPSPPPD
LEPVPSLTMDTPCPPPPPPVAIATPSPVIPIDNGFMPTEPKTKSSLKKDSYSVRPKHITY
EDKNVIIAEI
Download sequence
Identical sequences V4BEH2
XP_009062220.1.39240 jgi|Lotgi1|154773|fgenesh2_pg.C_sca_6000276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]