SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|154774|fgenesh2_pg.C_sca_6000277 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|154774|fgenesh2_pg.C_sca_6000277
Domain Number - Region: 41-73
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0144
Family Somatomedin B domain 0.0051
Further Details:      
 
Domain Number - Region: 216-285,312-336,398-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0298
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|154774|fgenesh2_pg.C_sca_6000277
Sequence length 605
Sequence
MGDLHYMVCVVVVFHCIYGTQSVDTYSNQTYNAAYLTFCGQSCISKTVIRNDWCSKCYCD
GDCHLYKNCCPDKKATDVEPKYMAYEYTCTTISFPELSKRTNLNTDLCSKYYKTCDNLEF
EVHPEAFFLIKSCPNSFTGSQEVVTRCENIIDMEDQSTIHPITNWLTQLSYRNIYCASCN
GVQETERWEMWLICRDVLPDRFGNNVNDLYHNFRTTEGCSIHFEPTNWQRQRTCHSGKKL
INSCNVTGLWSGDEPDLPSKCNQTYQYENPVFGYQNMFCYLCNIPDSPDTLEDIVGVVDD
NLSHLQPADYSVVDIDKKVCRPISCPDGRRLVNGICRSLFHRFNGYKYKICLKYEIMVSN
ATFPDSRRLVFKFISKIQHLVFWHGIYTVQNSLALLGMTPCLNGYLNATVVIGLHLTSRR
SQGSEDENIRLIQDNIVTIVGSEKTAPFNILSVEQLADCVVRDRIPKNSGGLCLKYKSSI
RPRPLRHVLAIGYIYLAKEVMFSKLLTCPQMVLEQNETVHDLHNGVITILANQKNLTSID
FRLVNGTYLICVEDYLQNAEIVETETCTHSFDYRPVIAESTSRVSGLNGSFYVCLLLFTV
ANIKV
Download sequence
Identical sequences V3ZXC5
XP_009062221.1.39240 jgi|Lotgi1|154774|fgenesh2_pg.C_sca_6000277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]