SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|154803|fgenesh2_pg.C_sca_6000306 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|154803|fgenesh2_pg.C_sca_6000306
Domain Number - Region: 26-81
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00112
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|154803|fgenesh2_pg.C_sca_6000306
Sequence length 204
Sequence
MNKFLCSVLLVLVGIWLATVGFTDAVQCTSDPIIINGVFDSDITSREVGAVYDFTCNGTL
EDTGTVTCDDIGDWTTNLTCEECYLPNKYFYMQYSFYCVSSEDECVQKCDEMNCKAYYTV
IRQNTWSSCYVFLPYIIFRGTGMSVQQCIDKCNEMDECLTIRYRPIRGDLCYLFKVTVTE
LVAMGNVLRSTSTGTIIGKRSICP
Download sequence
Identical sequences V4A1X6
XP_009062249.1.39240 jgi|Lotgi1|154803|fgenesh2_pg.C_sca_6000306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]