SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|154876|fgenesh2_pg.C_sca_7000025 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|154876|fgenesh2_pg.C_sca_7000025
Domain Number 1 Region: 106-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|154876|fgenesh2_pg.C_sca_7000025
Sequence length 244
Sequence
MVNTSTFFQHFKQSRFEYDDYHIGVNRASYGNPPSYCFTSNVTFVISYKMSLTCRIELAV
TIAVVIVSCVCGMKIDFTRLSHHKRSYYIPQKRGSECSGNPCPVDKPFLCKTSSTCIALK
YVCDNTFDCEDGFDEEKALCTAVSRPPIEQLFNFLTAEQDWIIPKLFGGVEPEFAAHGLA
VASDIDDLSMTLGLSPQNVKNLHKAFQAAMEGDERPLLAMNMPERSWHEVQYMLQQLLDS
GFKL
Download sequence
Identical sequences V3ZWS4
jgi|Lotgi1|154876|fgenesh2_pg.C_sca_7000025 XP_009063629.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]