SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|155178|fgenesh2_pg.C_sca_7000327 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|155178|fgenesh2_pg.C_sca_7000327
Domain Number 1 Region: 73-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|155178|fgenesh2_pg.C_sca_7000327
Sequence length 124
Sequence
MVLLRWENYTILIANLTDPFKVVLIAHVPYGDSYIALDELFMSNCEKENLRGVKTIRQSP
LKYLKRDALLKSGCLKDEFRCQSSLCISKDRICNLHHDCSDGEDESLTVCGMGPVHMVQP
VPIG
Download sequence
Identical sequences V3ZMZ2
XP_009063923.1.39240 jgi|Lotgi1|155178|fgenesh2_pg.C_sca_7000327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]