SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|155604|fgenesh2_pg.C_sca_8000392 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|155604|fgenesh2_pg.C_sca_8000392
Domain Number 1 Region: 78-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|155604|fgenesh2_pg.C_sca_8000392
Sequence length 160
Sequence
MSTSDRYIVCNIATTPPTSPRSGGPRVTTHRQDRYMIRQQLQNRFRMATETARQTIGNIQ
CAIVFVTADEKNLLKSKNECPEGTFPCKQGGCINRTLICNKELDCIDGSDEGNWCDPFLD
DYWDRYIRKRPDADREDESAECSKLISIYYNESLSMITLI
Download sequence
Identical sequences V4B6U4
XP_009065387.1.39240 jgi|Lotgi1|155604|fgenesh2_pg.C_sca_8000392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]