SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|156004|fgenesh2_pg.C_sca_10000037 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|156004|fgenesh2_pg.C_sca_10000037
Domain Number - Region: 177-218
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit II-like, transmembrane region 0.00392
Family Cytochrome c oxidase subunit II-like, transmembrane region 0.015
Further Details:      
 
Domain Number - Region: 125-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|156004|fgenesh2_pg.C_sca_10000037
Sequence length 258
Sequence
MNKYGAECEKRCDARQCSGISTCNHVTGECINDCKPGYQGIDCIQVQCTDGCKPGYREDD
CTVKCETGLYGAGCSKKYSDRKCDDNTNCDSKTGECIDGCQPGFQFTDCTLECDEGFYGY
NCSSNCSARFCQSEDQCSKIDGACDCLAGYQGTDCTLIKEASKDNDKDTGHDNKDTTIII
LAVVISILVVILIIFVVVFIKYRKSQGTNHTDNNVYESNGPTTAHIYDDLGSRNPENFTN
HPSSVYYNTSGVSIDASQ
Download sequence
Identical sequences V4CQN6
jgi|Lotgi1|156004|fgenesh2_pg.C_sca_10000037 XP_009044289.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]