SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|156364|fgenesh2_pg.C_sca_11000050 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|156364|fgenesh2_pg.C_sca_11000050
Domain Number 1 Region: 92-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|156364|fgenesh2_pg.C_sca_11000050
Sequence length 552
Sequence
MVTYLNINMKLILMIAITLVNFQLMDAGKGTNGDSLMKRDSVTSPETQPTILERCLNTTE
CLDNKQINKELKENCEDCKEGYCRLVLTSEFNCTSNSCKNAGTCIDDGETQVCQCPPGFL
GKICEYGKFGGRAVNDDDAQRLERRGGPHGSHDGHTGNHGHDSFGRRAVNGDDVQRLERR
GGPHGSHDGHTGYYGYDSFGRRAVNIDDVQRLERRGGPHGSHDGHTGNYGYDSFGRRAVN
IDDAQRLERRGGPHGSHDGHTGNHGYDSFGRRAVNIDDAQRLERRGGPHGSHTGHTGNYG
YDRFGGRAVNDDDAQRLERRGGPHGSHTGHTGNYGYDRFGGRAVNDDDAQRLERRGGPHG
SHDGHTGNHGYDSFGRRAVNVDDAQRLERRGGPHGSHDGHTGNHGYDSFGRRAANGDNAQ
RLESRGGPKVGNGIDGQGFGCRSGGSLRFGGNSTDTPRDEDDIHFYPNMETDQEAILYCE
SICESQPLCLSYYLYRGMYDNDDNIRYCFTFSELSQDLPLGNGTAYAIGDKTMQCIMTLE
DQVYQNTTEKLK
Download sequence
Identical sequences V4B0R4
jgi|Lotgi1|156364|fgenesh2_pg.C_sca_11000050 XP_009045285.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]