SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|156525|fgenesh2_pg.C_sca_11000211 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|156525|fgenesh2_pg.C_sca_11000211
Domain Number 1 Region: 226-325
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 7-101,153-179
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-16
Family C-type lectin domain 0.011
Further Details:      
 
Domain Number 3 Region: 690-753
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000131
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 966-1026
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000089
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 5 Region: 450-566
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000419
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 
Domain Number 6 Region: 630-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000236
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 565-640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000011
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 8 Region: 744-801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000514
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 9 Region: 858-943,998-1016
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000173
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 10 Region: 180-220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000503
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 11 Region: 340-449
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000432
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|156525|fgenesh2_pg.C_sca_11000211
Sequence length 1027
Sequence
MEVVSQASIDFHCEEGWVRDGGHCYLAVEIPTSFSNAERTCKGLSSKLVEIRDETENSFI
YGLVKQKSWKKVWILNSMIDQSDDWNTELILSEVFKNKASGMTTIMIQIELFLCLGSQFK
DLGYHAELCEAFGLFDLFEPKSKSLPNLEEKSECLAQNEDGKWEVAQCFERNQYICRTEA
CVEGGYRCHDNTGCISKKWVCDGERDCEASGSDEQNCPNQSTYEETGISGEIEVTNSNQY
KDNAYHTWTIIGPVGKQIKLSIENFNTEEHRDYVHIYDPIQTIDVATLSGQQSNQEFYMT
SNQALIEFKTDSSVIKSGFKIKWTSDIPELNSGVIELTATNDWQVITSPFYPNSPRYFYK
EWLIRAEKGEVISFKVKEFIKDTEEGTKFMVYIYDGEDLSPATEIIGIETATDSHFDFVI
TTKSNALRIIIHYYALVPPGQTGYRISYKKGCTFKLAQTHGMIHSPGYIKEEYSPSTTCS
WLITDPDNTNRPYTIVIEKLELADKVDNIKIFDEESMSTSYHSDGGFNEIVGSKSLAVGN
QFYLKFTSNLIQSAGKFSIKYSLGCPDIPTHPNMTISTSDTTPATMVDISCDTGYSFAQA
EYNGQQSISFVCLEGGKWNYDVYPTCQVTYCGVPPPIPNGYISNYTGSVMYNEQVEYTCY
DGFKMNTISPLATCLDTGSYSSDITCAASTCGDPPVVPNGRANTTGTDFASVATYSCDAG
YDLVGSVKLVCLTTGKWSHKEPQCFKKKCGIPSFKHASTVTKEPVEFESKVTYTCEDGYE
INGTDEITCGPDQTFDGEIICGVQMEPGGFKYVRNRLRFFLAVCLAVCLAVCDLTLGYFK
LKLSRKYFFKESTLLLSYLYFDDINECVGQQSVCGDDSDCMNTIGSYRCMCKSGFESRDS
FCHEINECDENNGGCDQVCTNNVGSYICGCNVGFTLFTENGVNNKVKSDKETGLRPGDVL
RFDHSCVRNICPRPANIEHGELLSRRQNFSFGDKVSYRCDIGFQLNEDEELECVSNGWNA
DPPICKS
Download sequence
Identical sequences V4CNG3
jgi|Lotgi1|156525|fgenesh2_pg.C_sca_11000211 XP_009045407.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]