SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|157000|fgenesh2_pg.C_sca_12000311 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|157000|fgenesh2_pg.C_sca_12000311
Domain Number 1 Region: 115-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 79-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 3 Region: 42-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000785
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|157000|fgenesh2_pg.C_sca_12000311
Sequence length 198
Sequence
MKDVEGTELNMMILIFTGILRHYTLKLDKKLSIHVLRSVLCFCDVGEQRCPNGTCIPESD
IQNGVEDCAEGKYDETGPFCNITYQLQCSNGRCISRDLFGNGVDDCNDNSDEVLNPCKLG
AFSCSNKKCVSITWVLDSMDDCGDGSDEAKRIGTACDDTHCCPCQDYVTDSRCKEKTCQC
IDGFYSNEARTTCLRRKI
Download sequence
Identical sequences V4CL87
XP_009046510.1.39240 jgi|Lotgi1|157000|fgenesh2_pg.C_sca_12000311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]