SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|157068|fgenesh2_pg.C_sca_13000002 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|157068|fgenesh2_pg.C_sca_13000002
Domain Number 1 Region: 48-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000851
Family Fucose binding lectin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|157068|fgenesh2_pg.C_sca_13000002
Sequence length 196
Sequence
MLCFTNISCVGFGYHEQRLECFLYDMFPVECQGVVNDIGMEIYVPSEEDKTNVAIGKPSV
MSTFHSLPYLPCNCVDGNTANDRLTVCHTQKLNPNWFCVDLENIYNFKQITIFNRQDGGS
INRIVNFQIRLSSVGACDESTFSSTPLCHQDPNPTGLVVYNITTCSGAVAFSSRYIFISN
SNGQFLTFSEIKVHAL
Download sequence
Identical sequences V4AWS1
jgi|Lotgi1|157068|fgenesh2_pg.C_sca_13000002 XP_009047096.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]