SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|157487|fgenesh2_pg.C_sca_14000110 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|157487|fgenesh2_pg.C_sca_14000110
Domain Number - Region: 318-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000311
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 276-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00236
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|157487|fgenesh2_pg.C_sca_14000110
Sequence length 358
Sequence
MSLNVSNGYQKKLWTKKFSNWKHKFHEPYDRLVVGELVVGDVVGLVVRLVEGTGCRRYCQ
TVTRNGECGNVNKTNNPGNDFTASARISDNTGGIGSFVPTDTLNNSTQCDERNEDSCDIT
HFERCSKDGLCKCLRGYLPNREDNKCVAAQFFRGEIPLDKNSLDKYGDKNTLNYEIRQVL
FSGFSSQGLTGILDIDVISMSKKDGNVVFEIALNKDTAPRRQQLQTMYNRGLTASAYVDI
DGMVKLSGTNLVLGQNVSMSQYLKLLSEFSHCVDPNYNYCDLNARCTHSMRTFTCQCEEG
FDDFSPDIFKAPGENCKVSCKCENNGTCSEGDGVSACVCPEWYIGTNCEINGKGHKSI
Download sequence
Identical sequences V4ABD2
jgi|Lotgi1|157487|fgenesh2_pg.C_sca_14000110 XP_009047943.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]