SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158014|fgenesh2_pg.C_sca_15000352 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|158014|fgenesh2_pg.C_sca_15000352
Domain Number 1 Region: 120-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-18
Family MAM domain 0.0044
Further Details:      
 
Domain Number 2 Region: 277-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000321
Family EGF-type module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158014|fgenesh2_pg.C_sca_15000352
Sequence length 516
Sequence
MPTSAPTKPTTKPTKPTAKPTKPTAKPTKPTIKPTKKPTSKPTNPTTKPTAKPTMPTSKP
TKPTTKPTKPTAKPTKPTAKPTKPTKKPTMPTSAPTNAPTPSLPTTKQPSTEPPATVATS
IQCGFDKDVCGFNLASDPDSLPWLIGNSSGPTTDFSPNKGRYLYFSFNREIPSDKDLLAH
MTSGKVDGHTYKCLLLRYKTSSNRSDIFNINIRDKSKTVLSKWTLSNQVINKWDLIEITL
PDDQNLQLQFEGLVMMDTKGYLAIDDWHLAQSLCKEKPRCLANPCKNQGTCKESLKSYVC
VCSEEFSGTNCETAITTRNPTTKKSQITARTLVTAQPLPSSSMSSKPPLVSLRTAVIGTL
PTSTDKISSAQTGKTQQTETLNPGSTQPHPITLGTAIPQSTEQLPTINLSMTAHTLVTAE
QITTTGSSVNETATESYGEALTKGETYALIAGGSLAVVVILSCLIARCYKKSSFKGGDIY
DDTYGKEYNGLPSSTDVKNPQDSELTVLNYTTHQHL
Download sequence
Identical sequences V4CFC5
jgi|Lotgi1|158014|fgenesh2_pg.C_sca_15000352 XP_009048839.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]