SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158076|fgenesh2_pg.C_sca_16000044 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|158076|fgenesh2_pg.C_sca_16000044
Domain Number 1 Region: 448-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000182
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158076|fgenesh2_pg.C_sca_16000044
Sequence length 581
Sequence
MYNQLLGMSRERDLSLKIYVVGGVCKVLLIDTGGGGLDKDHWGTNFVLTFPKLTDYKNKN
MVVITAREVTEVRVTSHQTGEVSAFSLSEGEAGRVIYGNEVETASYGVKLEDLAISVVAS
NKISVYAYGYSAHSTEGMLILPVPSLGIDYLVANFYNQTSSTQTIIIAADNNTEVNIQFK
LEANTHCDVGFNGFYDGDNFDFILNDHDVLNINCECDNTGSRITSNKPIGVITGNRNVKL
PMTSRIDPIMEMLPPVTELGTQFSLIAPTGHTSQKSMLRVVSLNSGTSFEIKGELYTPLK
GEAVDIKYLSQSEKICFNATDKVIVVIFMLGDPVSWYYDGDAYMSVVPPIDRATNDYMVF
NNALKSLDDYYKGGVNIVARNSVTDAIIPSLNYDQLCTGYNVHSEIIGDSQVKHYHAPSP
FLLLIYGYSIREAFGFPAGMKLSVFSGTDECASFPCQNGGWCIDTTTSFRCHCEDSRYTG
THCEIGKANIPILPFTVIIQNIPCLNIIIIISSTTKIIIVIVVVVRSKKLSRSSLFNNKQ
AIHHHHQHYHHHHHHHHHHHHPHHNHHHHHNLDNHRDSRSG
Download sequence
Identical sequences V4CDE6
jgi|Lotgi1|158076|fgenesh2_pg.C_sca_16000044 XP_009049359.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]