SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158324|fgenesh2_pg.C_sca_16000292 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|158324|fgenesh2_pg.C_sca_16000292
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-18
Family YWTD domain 0.00031
Further Details:      
 
Domain Number 2 Region: 246-479
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-17
Family YWTD domain 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|158324|fgenesh2_pg.C_sca_16000292
Domain Number - Region: 200-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 506-565
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0017
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158324|fgenesh2_pg.C_sca_16000292
Sequence length 810
Sequence
MAVDWITRNLYWSDSGLKQIMVSREDGRYPHRLFYDGVDEPRSIAVHPVKRFLFWCDAGV
ERPGIERSYLDGSNRTIIVARNRVQRPRALAIDFKDDRLYWTDGMVIHYGKLDGTGQFCL
HSSGRSTVRSLLVLQLYTVTNIFTMSSYHEFRLIHQLQSPRQKEFLSMPLIGFNLYRTVQ
SNRCSYKLPLYKNNGYCSQDACGIKNGDCEHLCLPSATGRTCACSLGYWKINETRCISGV
GDEKFLLFADQRQGAIFQRPLFLNEYYAIPLQGVKQPRDVVYDPVKKFFSAPCDTFFFIS
APYTLTLDAKSQLLYFVDIYKDLVVAVNLRNKQYAKIIEGDRFVAFQNIKNVALDPTRGM
MYISCQHKMISDNKTRLIGAIYSATMTGKNLTAFHIGPGEPKGLVVYEDEVIWIDSQKRY
IKGKATVNGSVYDLKRITESGQLHDITISDGYIYWTVLSGKPIKRSPLDNLTETETLGWD
NFYRVQSIDSYTGDTLNEFCLTRGVNNGTLVNNGRSRYVPVGYRLEILCNPGYKIKGKMT
AEDNRRGYVLCIGEGSWNKRAVCEFALLYEIHGTNNRGYVELTRSTYFLVPPRVKRLNVI
CIGGGGGGFDSNYKEFKKKDKAGDGQASSFSDKLISLGGEGGRLWRGGNGGIGTVLFGGE
GASANDCHYGGAAGQLTQKKGCYQPSTFCLYCGAGGSRGKGECPLCPLGLEGGCSGPLSS
NATKHAGCSYGGGSSGGSGGGGGGAGYSRAYVDVTPGEMVLVTVGKGGAPSYKPAGDGIV
VISWNGRIEDFKTDRIMMYEESNFEDKSCL
Download sequence
Identical sequences V4A7Z5
XP_009049285.1.39240 jgi|Lotgi1|158324|fgenesh2_pg.C_sca_16000292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]