SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158536|fgenesh2_pg.C_sca_17000187 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|158536|fgenesh2_pg.C_sca_17000187
Domain Number 1 Region: 16-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-16
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158536|fgenesh2_pg.C_sca_17000187
Sequence length 159
Sequence
MYSSYGSSTNFVPGECNSGVCFNGGQCRGGYSQSCSCPPGFQGPRCQYDVNECGINNGGC
ERECCNSIGSFKCKCPQGFELAADGRRCTDIDECRDHNGGCQHKCLNTDGGFSCECPKGQ
RLHADGRTCIDTEPLNGYTRVNSSSLEAVVSFKCLLMTY
Download sequence
Identical sequences V4AQF0
XP_009049939.1.39240 jgi|Lotgi1|158536|fgenesh2_pg.C_sca_17000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]