SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158707|fgenesh2_pg.C_sca_18000057 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|158707|fgenesh2_pg.C_sca_18000057
Domain Number 1 Region: 37-269
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-36
Family YWTD domain 0.0000863
Further Details:      
 
Domain Number 2 Region: 311-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158707|fgenesh2_pg.C_sca_18000057
Sequence length 357
Sequence
MEKSWYLLTCFLSIVNGFRFPTPSTLFTENHLKDDEGPLLAVLDFNKRLQVLNTTSAKRI
AKIGLLGGNNGASANINFNYEDGLIYWTDVSSKKVYSLNAETGEQKVILEGDLRSPEGLT
YDWIHKNCYVCDPFGNKIVVFNTVTGLRKTLIEVENPKDVAADPRNGWLYIAHGWESTAR
ISRSGLNGENMQELTARLEIPYSISLDFVGNKLYYTDWNKILSMKLNGERIRTFYRTSGY
DYTPNTMTVSREYVFWTTSIEEQVRRKKKRGSTRIIKFNALENYNRYNSQTDSYMGIVAI
HSQNQPATASLCGDNNGGCSHFCLPSPVDLHLSPSFTCHCPDDMELTDDNKTCDCNM
Download sequence
Identical sequences V4AYK8
XP_009050398.1.39240 jgi|Lotgi1|158707|fgenesh2_pg.C_sca_18000057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]