SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158756|fgenesh2_pg.C_sca_18000106 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|158756|fgenesh2_pg.C_sca_18000106
Domain Number - Region: 345-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.062
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158756|fgenesh2_pg.C_sca_18000106
Sequence length 3543
Sequence
MEMLVSLVLTIFVTLIHKSNSSGQLEINVLSFRNPAGLNIDGSCCDGVNLVDEQCPTGSC
DHAIEVCVSQIDGLNEKCKIFVGPPDTNDITFYDNNQFLYSFDRWQGGVLISVNITDLDS
GKSDLVDYYNITLTKDTVASYLQLPTVENYNFTGSRYLNATSLQFSVSTYCDSYYYQDCS
VRCIDNDECDGHYTCGSKGAKICNFGWRGTNCDQIIQGSQKDCSVYDTSIFEISKWISNF
ECYGANDELLLDITEVLQETKEIFGTITINTTETSVEGHYNPLGLQLSSTDFAIGTYLNL
TFFDMSATKKNATHLDGVFRFRSSGDDHRCPLKLDRISGEDDIAPNRCDDKGTCVRYGAA
KSQTYCCCYDGSQGKTCKSSVTTKPSFFTSITTMKTSTSATSQASTTETATSPASSTPIV
TSLESTTLTTPESVTSSTTSESTQASSGVTSSGVTSSGVTSSGVTSSGVTSSGVTSPVMS
SISTSPNFGETTDMSSSTDSSTTQTLESQSTEEITQPSPSAPSSSQTTMSSVSTSSTSEK
AFETSITELGTDSTSTSSQSKITSIETTTNQPVTDAMTESTTTDMLETPESTMQPTTEIP
KPFIPDKSYQLKLEAAPEELKDDDRNLEDVITEAYYEANIDVVEKRLIIANVTDKRDALG
DDGVLIVEVTYTLVINSTTINTSTINQPTTAQWTFVLHRNYAISVYLGVDIWYLEYTYSF
YALGRPPVIQQYNEMELEIFNVWELNSRLVNESYNITILTTEEYVGEMGEEVYRLYYIVT
NINTSSMYHPSNTTAPSAVQLDASNIFTIYHGISTRYRFSYGVIFYDVIDQSELVELSTV
SEKVWDGFTTLNVSVIPIRVERYMGKEGEYLMKFLYFVKRGSRLISPIQWKGPAPKNFKS
WLEVIDINNRYLRVYTSDVHYRYAHHTGLYIEDRIDRKDWTVMKEQLEKTWSELVIGWNK
NGFSIKIVATIDYTTNTSEMVQLLTYYIYRKGMIIDASLLDTHFSVTKELETRFKVMRTY
GDQYIVITQRTFVELRTQYSFYVGGIISKTDFSYFEQSLISTWNLTKGYTESDLTVKITY
IDERIDIKTEMTVSKIYYTLQYKLQLVDAYAVKISQNFTIHLESAFNVHTKYQKYMLYKQ
TVTNLITKRYSYSLYFTSKMTRLDFTTLQRRLYSVLKTYLGLSYEFEIIVANQEEYYTVF
DKESFEMSSTRSTVWKINYFIKTSNLWVYPKFVKKIYQSDLKTSLQFEMINKKTSNIYLE
SRNELISYSYHFSLDFKEPIYYTDWLQIQISLETAWKKQTGMAVKISIQNVEQLVDVEGN
IYYSMVYFIQHQQSWIYSLNWQTLDLTILKLDFLNVHGYKYEYFSIKEEWKLSYSFHIGS
DLTVSSTDITTLKLILRETWCYSLATFISDCSKIEIFPVKQVSETSQSGIKGWDFRYFIK
YEGNVIDVSTWPALNIHQFLQYYQSHSFVYKYKFFLNLNYLYRYFQFKIYLNTHVERTDY
DKIKESILSSWLKQNTRFNSTTGLKVIIDSQKEKVDIHGESSWELGYHIEVNGNTLRPEA
TKPLKPSDLQIEIHNKTINGKYEISSTTSKTSSSLISTSSFAGLIVNSKIEREDKYKFQS
ALEMYFRNISNIGAESNVTVTIGPMKEVISANGHHAWELTYHVAVNGSSVSVEKLKQQID
YSYLQHFLQIKTKYGKTVSVSSSNTTQKKSMLFSVALSHKVTKINLENNIATQLTKVFKE
LNPEYENCSCLGVKIWNLQEQISATGESTWKVEYQVNVNGRPIDASLVTWPEWKLLNKYL
KHKTSTGYEVNVVDTTNIDYRSTSLFHSLYFNSFIAQSTYTNIKTSLTASWSKTFEKLGI
VGDLKFKFWRYSEWSSTLKKSVWKLDYEIMLNSTRLDITTVDIDKTSYNLLQQSISNIQS
PSGVKYKLIDVSTFKLREYAMHFPLYFTTMVSQSGFVSIKEFIKKTWYDHWKEMNFNQTE
VEIHEQKVMVDMEGKFVYQLVYFLTHNGEVVDSRLYGYQKILDYISTNLKLINPRGQYYK
VLSKVSHLIREETLFNIVIHRPLTTSTKVQFLEFIKSAVSSNMTGQKLSIDVLQQEEVLT
ETSMSVWKVKFYIKSEGEYIVPATVDGLSAMDLYSAYLNTSLNLNFNVLQFKKDQLYSYK
DRFVLFFKKNVSETHWSILTDALVSFWNNHTEYKDCNCVSIKIKGMQEVVDRNGITRFKL
VYFLYKSNVLVSSQISVDVEFEVLQNVLVKKSTSYEMIKITETESTRIDSTFSIYLNRGI
RFDHREVTEQAILDVLITKNENCCTNVEILRQMEFLTIKGKSLWQTVFKVTSLNVTVDVK
RLESINATSLQETLHQNLLEYQIEDNTTMILDLRKSYSLYLTTPVRQTDLIHFQQAVYRY
IRKSVSVNISVIVPQVTQVVDIEGSLYQKLSAFTTFNGVQAYPGQGGNLNITLIQQEINS
MGIKGAKAEYTLIDREITEHDVHYSYSLEQFIDRPVKHKDLKTFQHVLELSWTRAIRAEW
KFKIDFDIKIEIVRQEEYLDISGKSVYKLVYYLHKIRDNMTQGELPSNQLPKLPVDKIHL
QVLIDVLVIGEYKLVKTTEIVQYSSLFTVFLKSPVLLPDIDIIQSNLQQQWSWYLKKEVS
SVVIVSQEEVVDVSSRSSMWQVSYTVKSSSTIHIDSNYQEELNETDYRLALDVNYTDTGN
SYKDLITSRPDSSTKIIRYKETYSVYFTQRIIETFYSKFETALISSWKLSRNETVNITIA
GQQEVIAETGMTSFKLLYIVSKSEKQITLYNNELSYNELKNTIVISTAVGTNYKVMEVEE
SFKLEAAFQVYVSQAVYRVDRTLFKEAVKTELGRLMPDSKWTIAIREPEEYIGANGAVVT
RIPYLVMQNSTVTFPDVTRAPTATSIVAHMSTQLKETFSVYDGKKLVKYNSCFTLSVKRE
VGFNIQTNEIEVILTRTWRSVTQEKDVVVSIESTENFVGDFGVKIDQILYTVTLDKIATE
PSFDIKPNDTLVLHEINNVMKYRWSLYKGVNTYRLGVLFSLDVAYSSSLFFTIETKRLIE
ASLEDVWSTNNPTVCENCTVSVVSRKMKIGYNKTIAMDVQETVVAQLHYMVQSKGEYLKS
YQTTAPTSELINTHLNQFELVVWTEQTFVARSVYFEGYSWNEKDEIYSAGLHEAWKQDST
TEINITLIDVTRYVDENWNKLTKVQYIVFVNGSDPVQAQLNNTDITAAFNKIGEEKSACS
CKPLKHRKLFVKGSPGSVDHKSVGIAIRAAWMNVNHNSSSLHQLLKVKTKKENSRKKRAV
SESTNQTKYIGDDGDEISPVDYTLSVNDQEPDPVFLNSPTEDDLDAAGVNGCNCSPRKAG
SLRLDGDVEDSQFDDVKKAVYEAVVKANPDISAEDLEVDILNLSDGIKDSNNNELSEVNY
AINRKDGGDIEDVNYPTSAHLDEALKNHGLALYEKRAPSDEEDDDWKVIVGAVFGAIAAL
IIVVVATYIIVQKRRKQRKMNLKKQERDVSNDIYDEENFSSAVAYSNQVYETQEAKIDFR
EPE
Download sequence
Identical sequences V4AV04
XP_009050441.1.39240 jgi|Lotgi1|158756|fgenesh2_pg.C_sca_18000106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]