SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|158870|fgenesh2_pg.C_sca_18000220 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|158870|fgenesh2_pg.C_sca_18000220
Domain Number - Region: 434-481
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0405
Family Pentapeptide repeats 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|158870|fgenesh2_pg.C_sca_18000220
Sequence length 720
Sequence
MEKKQYHKFLTMTKTKLSDFFSLRMVKIFVRKNQLTTVIIACFLTTCIGYLIVRPRYVHQ
YNPQDDDLVHKFTIVDDDSVDEKSSVDPVQNISTWQKTSGNRVKSKIHADKLILTTDTKF
VSHIPGWTIVTLGPKLKCGMESSEKFKETVHQAVKDGVQFIYKSTEYQPKTLHYLDRFNY
DKTMPVMKYMGNSTTPVKNHFIVINENYQKRNFAEMRYNVSVWRTAPIQKILLRNEINRG
GDVDDRAPPIAISIKNSRYTFVKDMILFRYDAFWAMVPFKDNELWSMWVQKLLLELKTWV
TFTTVSPLQHLCSNNGKLSHNDLNHIARWKCKSRSNFFECVKDFNRFLVSNKFMDSTQEK
TITKWLKMLTIAGYTQPSLNPNNDSTGLVYRAIFRPKSVDSLYSMKQSYHNICGKTQPAC
PFKTVKKSTKKFSTILLNVVFNHATFYKITEYLANIYRPHFTHINFCGTKMDNFLPYNAK
LDIPVSFIEMDDKEFQKGQFDHRCIEGAMKMNYDIDGVFHVNDDILLNLWNLPGIPTDRV
WFQKDLQVVPFSTARLPSVYWKRAQMNITWWPWHNNNMGRMKLKGSIDTLRNLSKTEPLA
ATYINQVDKNTGGKRDIGFAGNTDIAYFPKKTFKTYLYAAQVQSPFTIFLELAVPGLIAG
VTNLYDVVTLPGKYIWFDERPFYAQHYNVSHVFLHSLKIGGCLPKKPCKQFLCEKYLSCL
Download sequence
Identical sequences V4A4V7
XP_009050537.1.39240 jgi|Lotgi1|158870|fgenesh2_pg.C_sca_18000220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]