SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|159185|fgenesh2_pg.C_sca_19000222 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|159185|fgenesh2_pg.C_sca_19000222
Domain Number - Region: 812-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000302
Family Integrin beta EGF-like domains 0.053
Further Details:      
 
Domain Number - Region: 462-496
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.0732
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|159185|fgenesh2_pg.C_sca_19000222
Sequence length 1141
Sequence
MVDLKNGIGRRCPWLMDDVCGKPCTTQSASCIADFKYQLLSGTDTDICGLIKLAKECIIS
KSNTCGAKQKQAGLDRLDKAIEGLNIPVNCEDGNAVQKCLISNRQAVLSELSQRASVSDG
DAVCSSITSMNECIENEKDGDEVPQAIRDILDAVFPLKLDCSANLDGSCAFKDIKSATQR
LLDFLIAVASDQTSDFEKDVYCSKLKVLEDYVSGLVGECNDRGLGKVLNGMQSFCEPDNG
CDDLETTLDACVSLYTQVKNDEDKSCIGIQLARICLSSAVTGCTGSTVTTLLNTRLQLLL
TDPLCPPIPQFKLATSTKKTIYLLEGGPSFPLSVSLLESPGDNAILKLTVKASNMASSPP
KCRSEDDEGFQQIHVTNPNSLEFTKDNFNKAITFDLSAVLDGRVDGSQTMMVQIVADLVV
NGNIKYSDLIAEYTVLVVDRDDKTAICSSINDPHVKTFDKLLYDNQLQGKFVLYKHQTLP
YMVQVTYQKCAEEGTCNCRVQILSGDDVIDFNRCYTETDDRDVSKPLELSITRTGDFTHN
TQIYSQDEGRRFYVLLPTGTLVQIRLGDFYMNVWITPSVVDKDHTEGLCGVYNGDTYDDL
RLPNGDKYTVIDADKTGGVLTVNDFSKEWRVIIDSDNDLSVSSTAYYSDVTSTKQYTVEA
CGLVQGIDITSDLVSESEEYATDGRKKRAVANDNIDIDESAKPSVSEWPTKTGWTLNNAT
KFCQDNILSWGVTQKCLEAISAIGGKTNFETEVNNCVADIKLSGNTNWVDSAKDDVLQNC
LNELNKDVQYLNNPEAKLQAEAVMSSSCNPSDCNGNGQCTTGTCICKKDYYGSDCSMKED
ELPTPVLYSIKNNGECILSDKSSCTNVFISGRQFIQSEKLTCHIQPLEVTETGHKAVGQP
TIVIAKLLTLNQISCKVSGIKTPTTSLHISISNNGKSTSNKLMYIAYNVAIHQCNALEGT
CKLQSNLCKIGGQVYNKDESLPTDKCLYCNPEESQTRWSSKSEAGCEIIAERRDDNPSGL
GLTETIIIGVIGGLAFFIIVAILIKFVLVKRNRRTPKRVDDTEVALPPSPKSPQERELQI
FQNEVYVSSDDLKDENDSMPELNDSRYFDDRSASERCSTRIKPRINTQSMSGPFVTKIDI
N
Download sequence
Identical sequences V4ATY6
XP_009051074.1.39240 jgi|Lotgi1|159185|fgenesh2_pg.C_sca_19000222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]