SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|159188|fgenesh2_pg.C_sca_19000225 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|159188|fgenesh2_pg.C_sca_19000225
Domain Number 1 Region: 60-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.17e-20
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0015
Further Details:      
 
Domain Number 2 Region: 22-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 467-501
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|159188|fgenesh2_pg.C_sca_19000225
Domain Number - Region: 208-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|159188|fgenesh2_pg.C_sca_19000225
Sequence length 776
Sequence
MRGPTWSVILLLINLIVTLQACDDVTEFQCADNNQCISKTDTCNTINDCDDGSDENNCAC
LEKLGMEDGTILDSSLIASSSKTGSSPSYARASNDKGNWCPKSDDSKPFFKVKFDTPRAI
SAIVFTLKQSVVDPLNYLSTWTLKAVLPGSDEEVTLYEGLNAFSNNSLYRSLFFPSLVTD
TFIIAPTTWQNEPCLSFELYGCNIDNLCPTGCQNNGKCSGNDICACADGYFGTKCQFQKT
TIPFSSYIFKSLESGSLVTSSETFTVRTSTTIRTSKIIEIQGRKVLSLPVADYFTAPKDG
KFGCLSKLGSGGCKSFYLALGCELEELKDTVQLFTTGSDSTYIGAEATLKSDNLVVTFRT
SELIWTLNVRKTNMFSSSIKYVLEFDWDISTGIRIYVNKKLIGQQRQATRTTQVLRTNTL
ATSGVEFFKSKSVNVKLFSLKSSSVNRISLIKTSLISLTPTEECDQEKEHKCANSDKCID
KSNVCDSVEDCDDGSDEQNCPTTTCDVKVYKKLVTKSASLSLDLLEVDDAQRVAKCTLPV
ISYVVDGILLDFLSKNQYGDQLSATNDLGANQNHNNNNKDDNNNNKKSSQDEFKEDVFNW
ADEPWTPCDDVEVPDWARMDDPTFDNFNSELIWAEDPWTQLPLVGLPSWMLLPGIDYPVE
AKDPVVYTPVNDEDDAAFLASGIDIVNWSDEPYFQLPLDVPRWALLPGIDYPVRHGYNSP
YWTYKLNQYNSSRREFGKKMFARQFPTLREERVLYNNNGQSKLCIPGNFQRRNHRF
Download sequence
Identical sequences V4A3H0
jgi|Lotgi1|159188|fgenesh2_pg.C_sca_19000225 XP_009051077.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]