SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|159932|fgenesh2_pg.C_sca_22000143 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|159932|fgenesh2_pg.C_sca_22000143
Domain Number - Region: 460-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000495
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|159932|fgenesh2_pg.C_sca_22000143
Sequence length 674
Sequence
MSFLYIGRISKNFQTPEILDTHGFEVSNFDGIEISHWGNYFVFTFLKCFSDFETNVDNII
VVTTRNVSSTISIICMETNETWEVSLEPFEEYKLHLNSSVTAIPFGEILPRKAIVVMAST
KVSVYGFSANGSSVDGFLVIPVAGLGNEYRTVSPVTYRATHSYPEGGPQFAVVAVEDETN
LTITFTINNRCIINKQHRWNIGQLKTFTLSTYDVLNIWCASDTTGSLVQSSKPVAVLSGS
IAVAIPISAYPNHVVEMLPPTKDYGYQWVVQAPTGTDYSSMYRIIFHENNTTISFYDPPE
IFYPGDFIDVEIENDDKQQFCFSTNKPVLVVLINRGTNEPSSTYQYQGEAYMSIIPPYEK
YGNYYVVPYGLITNATDRLAIIGYTEYRHLLVPQVTPYESVEHCDDVFETSIVSLPYSSQ
VKSSVYHCAQPFAVLMYGYNVKLGYGLPGGFNVTDTSGEEECLSSPCLDNGWCIETSLSF
FCYYAEMTTTTANYNSSYVTEYSTTESTISDTPSSTTEDTSTTNDVTTNNTTEEASNTTG
TESNLTTTQIPKLTKYPTTTNSTTVSISEFRRIYFLCECPCVNRLDTTKNLLIHEEEQKK
NILSKANLSKTQREKTSADNITKAEQDLGFTAVFIMTSICSIIVLLDLLKLAGWIRGYIC
RRKQTLEESQQRSW
Download sequence
Identical sequences V4AS26
jgi|Lotgi1|159932|fgenesh2_pg.C_sca_22000143 XP_009052869.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]