SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160001|fgenesh2_pg.C_sca_23000019 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|160001|fgenesh2_pg.C_sca_23000019
Domain Number - Region: 63-103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00344
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number - Region: 160-207
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0706
Family Anti-platelet protein 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160001|fgenesh2_pg.C_sca_23000019
Sequence length 220
Sequence
MMMESSINSATILPPYEEEFEPVDNLHWSPETANSIYLFWIHQLQASNCSTYPNVTDANF
DKDCNGNVVITCSKGFQMEQGLECVEEEWSYQNPICKRTECSYKYSNETDVHPIEIDYEM
ASDQAQCDDNCKFTAGCAVSFFDPDSYCHLYTAPLIFMSYNTDLNQCIEKCKERSDCVTV
SSRISDTQSCYLLNVTQAEIPGDWKGDNSMGKCTVVEKIC
Download sequence
Identical sequences V3ZWW8
XP_009053139.1.39240 jgi|Lotgi1|160001|fgenesh2_pg.C_sca_23000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]