SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160109|fgenesh2_pg.C_sca_23000127 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|160109|fgenesh2_pg.C_sca_23000127
Domain Number - Region: 111-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 20-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00024
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 51-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 141-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000275
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 170-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000283
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 81-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160109|fgenesh2_pg.C_sca_23000127
Sequence length 233
Sequence
MGSFKVYVSMFALIAMLKKANPCKNGGTEQSDGTCVCTVQFTGTTCEEKVNPCKNGGIDL
PNVGCICTADFTGPTCKERVNPCKNGGVQLSSGKCFCSQNFTGPTCEEKVNPCKNGGTEQ
SDGTCICTQNFTGPTCEERVNPCKNGGFELIAGRCFCTQNFTGPTCEERVNPCQNNGTLL
SDGSCNCTQSFTGPTCEVRRCQLFGERICKSHCSVSEREIDLFCEGNDLCCEI
Download sequence
Identical sequences V4AGT8
XP_009053237.1.39240 jgi|Lotgi1|160109|fgenesh2_pg.C_sca_23000127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]