SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160112|fgenesh2_pg.C_sca_23000130 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|160112|fgenesh2_pg.C_sca_23000130
Domain Number - Region: 70-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000492
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 223-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000578
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 193-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000599
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 133-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000896
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 163-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 253-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 282-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00752
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 105-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00781
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160112|fgenesh2_pg.C_sca_23000130
Sequence length 315
Sequence
MGSFKVYVSMVSMFVLIAMFNSSSGFYFYHALCPKEILSQLCNLGRFLRNVCLKEILSQL
CNLGRFLRNVCLKVNPCQNGGKEQPDGTCVCTDEYTGTTCEEKVNPCKNGGMPSVGCVCT
AYYIGSTCEEKVNPCKNGGTEQASGRCDCTDEYTGPTCEEKVNPCKNGGTEQPSGRCDCT
DEYTGPTCEEKVNPCKNGGTESPSGRCDCTDKYTGPTCEEKVNPCKNGGTESPSGRCDCT
DKYTGPTCEEKVNPCKNGGTEQPSGRCDCTDKYTGPTCEEKGNPCKNGGTELSDGTCRCI
YRYYTGPTCESQYNV
Download sequence
Identical sequences V4AMX2
XP_009053240.1.39240 jgi|Lotgi1|160112|fgenesh2_pg.C_sca_23000130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]