SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160117|fgenesh2_pg.C_sca_23000135 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|160117|fgenesh2_pg.C_sca_23000135
Domain Number 1 Region: 86-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|160117|fgenesh2_pg.C_sca_23000135
Domain Number - Region: 53-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00062
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160117|fgenesh2_pg.C_sca_23000135
Sequence length 174
Sequence
MGSFKVYVSMFVLIAMLNSSSSYEMASRNNFEPSLRDCLSDDIVPTLQGSFCPKANPCKN
GGKEQPDGTCVCTDEYTGTTCEEKVNPCKNGGIDLPSVGCVCTFDFTGSTCEVSTDDNIE
YLAFGEKPAHVDNKFNTHMRNFFLYYSLQIENFESKPYLATTEIVRTCSAYQTF
Download sequence
Identical sequences V4AMX6
jgi|Lotgi1|160117|fgenesh2_pg.C_sca_23000135 XP_009053245.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]