SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160146|fgenesh2_pg.C_sca_23000164 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|160146|fgenesh2_pg.C_sca_23000164
Domain Number 1 Region: 213-374
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.84e-21
Family Fibrinogen C-terminal domain-like 0.00073
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|160146|fgenesh2_pg.C_sca_23000164
Domain Number - Region: 153-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000246
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 34-88
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00141
Family Hairpin loop containing domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160146|fgenesh2_pg.C_sca_23000164
Sequence length 395
Sequence
MCVGLLRADIVTNSFHKVGDCSAASVAPAFVGKVKSRSRIHCSTQCSKISECNSVIYQAA
TKTCLFYDANEGTCPSTNGREVDVYKKNAVVSTLSSVSSDSPTTSYSNIGSTEQVMEETS
QTLQSNGIQNLHTDISTSTSTQSTSNSTISSVTNYDPSCVHGNYYMDNGRSLCICNDGFM
GTDCRERFTRCTDWSNYLSTLKNWDVSSDYYTTQYSRQVTIQPPNSPQPFSVQCKFTSFT
AETYVYMNTEKDRNNFDKTWSKMKEGFVFNGGFWIGMDRLYELITNERSFGEQTMIVTWV
ESNSRKYTVMVVNNLQIGNETTNYQVQYTNGRLGYFSSFPDLNGAMFSTKDNDNDGVSDL
NCANKNKRAFWYNGECSFDTLILFHIKLRKYSTWP
Download sequence
Identical sequences V4C3N8
XP_009053274.1.39240 jgi|Lotgi1|160146|fgenesh2_pg.C_sca_23000164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]