SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160156|fgenesh2_pg.C_sca_23000174 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|160156|fgenesh2_pg.C_sca_23000174
Domain Number - Region: 44-128
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0542
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160156|fgenesh2_pg.C_sca_23000174
Sequence length 228
Sequence
MGALLNWNISFVFVFMCTFYCGVFSSNSYHYKQQHTCKNVQKEFQELNIGDKSLVPDLPV
HVAHLAVCHKGLHHPGQRLCCNNGTVDKYHTAANKYLMDSLHSGTAFLKKFLMDKLKDYE
MVFLYRCIIDVLSTILTVVFLYRCIIDVLSTILTVVFLYRCIIDVLSTILTVVFLYCSII
DVLSTILTVVFLYRCIIDVLSTILTVVFLYRCIIDVLSTILSIAILHI
Download sequence
Identical sequences V4AGY2
XP_009053282.1.39240 jgi|Lotgi1|160156|fgenesh2_pg.C_sca_23000174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]