SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|161520|fgenesh2_pg.C_sca_29000207 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|161520|fgenesh2_pg.C_sca_29000207
Domain Number 1 Region: 304-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000363
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 610-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000932
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 3 Region: 573-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000227
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 353-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 475-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000177
Family EGF-type module 0.024
Further Details:      
 
Domain Number 6 Region: 649-688
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000419
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 7 Region: 72-243
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0000209
Family Hemolysin E (HlyE, ClyA, SheA) 0.0088
Further Details:      
 
Domain Number 8 Region: 433-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|161520|fgenesh2_pg.C_sca_29000207
Domain Number - Region: 526-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000657
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 395-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00665
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|161520|fgenesh2_pg.C_sca_29000207
Sequence length 689
Sequence
MAAYVRWKSPLKFLVLFSLIASTSQNSRQKREILPDQPRIVTQNGNLVFQTGTGHDITFK
AINGGKIKLGESDITDLAISVESNRNDIDQIKNSPTALPSNLVNRVDDLKTKVDNLATTG
EVANKLSGLRTDVTSLQSTVNTNRNDIDRIKNAPTSLPSNLATRFDTLKTRVDNLATTGD
VANKLTSLRNDVTSLQSTRNDLTSRISAVETSINQPTGNVKSQLTSMSSRLDTLEGRIST
LESTSSSSSTTGVTALQTRPLPSGGGSRGSGSSRGRSRSYRRLASRVTTLEEQVRNLQTL
LTRRECDSHPCRNGGTCLDLFNGFICKCNSYWTGPTCETDVNECSTLAGTDLGCQNDGTC
VNKVNGFECHCPANWHGIRCTESHDDCTGASQTELCGHGTCINIPRVSQGQAKYKCICDD
GWTKTTGNPACTVDVDECTQATTSCSRDPLVQCINIPGSFRCGSCPSGFTGNGYTCTDIN
ECLSNNGGCSLAPRVDCINTRGSRRCASCPSGYQGDGVSCSWVGVCGVNNGGCSIVATCR
ETPGFAGRSCTCPSGYSGNGIGSNGCTRSSPQTGSCANQHCQNGGTCQPSGSGYICQCTT
GYTGSNCQSDINECTNNPCQNGGRCINSIGSFSCNCTTDYTGPTCQQAQQSCGGTLRGES
GSLSFPRTTGTTYPHSVSCAWVIETTSGK
Download sequence
Identical sequences V4AGK3
jgi|Lotgi1|161520|fgenesh2_pg.C_sca_29000207 XP_009055137.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]