SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|161733|fgenesh2_pg.C_sca_30000153 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|161733|fgenesh2_pg.C_sca_30000153
Domain Number 1 Region: 1763-1822
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000392
Family ATI-like 0.024
Further Details:      
 
Domain Number 2 Region: 807-932
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000636
Family C-type lectin domain 0.019
Further Details:      
 
Domain Number 3 Region: 1875-2008
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|161733|fgenesh2_pg.C_sca_30000153
Domain Number - Region: 323-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 671-731
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00294
Family BSTI 0.082
Further Details:      
 
Domain Number - Region: 2037-2086
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00647
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number - Region: 1394-1430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0878
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|161733|fgenesh2_pg.C_sca_30000153
Sequence length 2407
Sequence
MYVDDIGKIGRAHQEDQEILEEIDLTAHQEDQEILEEIDLIAHQEDQEILKEIDLIAHQE
DQEILEEVDLIAHQEDQEILEEVDLIAHQEDQEILEEVDLIAHQEDQEILEEIELKVHQE
DQEILEEIELKAHQEDQEILEEIELKAHQEDQEILEEIELKAHQEDQEILEEIELKAHQE
DQEILEEIELKAHQEDQEILEEIELKAHQEDQEILEEKELIANQEDQEILEERNLKDHLK
KIPKKRPSGKSKPVKPIRRPGRLSLTVEQAIAKEPTVCKNPSKITFEPPEKAGDVITVDL
KRGFKCRGACITRYSVFFTCPKDVDECAPEETGTNACSGGKQCSNTFGHFICKCPPGSEL
IKRKGICKSRNECSCSGDPHCLTYFGHKIDFMGKCKYLISGVCKAIQSNQKVWRVECKNT
KCGKPNKDVTCTTWCETTIFKTGGDSVEKDVIRMERKGIMKVNGNRIADSQRFSNFDVAV
SGKQSTLMTDFDLKVVFDGRSRIYVYAPDGYQGKLCGICGDIGADGSYSYELGDTKEAFV
PVFKSKRNKVFNPRSALDYGNSWQVNDPADPKCKKVDKPTEGCSVEKDAFYRAPERCGKI
RTLLEDLKSEIVLSEDQAKKFNPEEDIESCAFDSCAEESKADEIICDAVEGYASKLFKAT
GTTLEWRTDDFCSLNCGPKETPKLNAKCDVECGQERSILDSCDGEAKDRCVCKNPFRRKG
TDCVSVSMCSCDVPITVAGAGNAFFKLQSGEEALNGDCSQKIRCANGKTTDIEAVTLDPN
AECKVVDSRTKVVCNDHFELDANGKCVSQGECSFPFIELENKCVYVTGKRKTWREAVRLC
NALGGHLLNLGDKNLGVFNDLPIFWVAGLKADPTTAAKFDQAGYENYKLPGAVQATAVEN
NCVRFEPNTRSFIHSSCFSDTIRYQVICEAYPDKAKTVTTEECSGAQPDDDGNELETVIG
IQMANPTCICSNPVDIKCFANGAEVTSTDSVTCGATDEGKLLDCAKADGVSCPDHTVKGK
CQPIFNLNKFGILLRMVIAIFTNVKLLQTSSYQCQAITNFIFTMSSYYKLLLHNVKLLQT
SPSQCQANTNFFFLMSRYYKLRLHNVKLLQTSPSQSQAITNFIFTMSSYNKLHLHNVKLL
QTSSSLCQAITNFFPSMSSYYKLHLHYVKLLQTSFPQCQAITNFFFTMSSYYKLHLYNVM
LLQTSSSQCQAITNFFLSMSSYYKLLLHNVKLLQTSPSQCQANTNFFFLMSRYYKLRLHN
VKLLQTSPSQSQAITNFIFTMSSYNKLHLHNVKLLQTSSSLCQAITNFFPSMSSYYKLHL
HYVKLLQTSFPQCQAITNFFFTMSSYYKLHLYNVMLLQTSSSQCQAITNFFLSMSSYYKL
HLHNVKLLQTPSSQYVNECEEFGNLVCGNKENCEDEYGAFRCVCDDGQLFINGVCEETST
CTVEVTNPDTFKLTTFASTPFAKPTGQCKLSLLKCLDLIIFVSKTADNLKTLSLKGICSE
IDLVETSSILPINNIMVNNNLLANSVESGSCKIEKDVDSVTITAFDKSFELTINEDFDVS
LQLIDSKSDCLGLCKVGSDIETIFRSCLDPDTAASTGGGETGSNPGQSPGGTEQPTGAPP
PQPPSPPPPGPENPPEPTVPGGTAPPPPPTQPPSPPPEGPENPAGPTAEVPIPGPPTEPV
PPPAGPDQCNTDMSADDKCGIVTDAAGPFSGCGNAKDIFDLCLRDICMQNMDICQALVNA
QKACVGQSFTRELVVAYKMEAGCEEDCPENMIFSFTPPPPSSCKNKHPVVPEERPTPPPG
CFCKPGFYLEEGECIPSSQCGCVDKDGLYHELDDVWFSDGCSTMFSCKAGSVKTLPYTLI
ENSNCGQVDNKPYPECSKGFMGVATELCNKVEEKDDSYCADVPDGDITKRVCLCKKGFVS
DCESCVDLDECQTGFAKCGANEKCVNLRGNYTCECAPGYERGNLGVCININECQREGMGM
CQPNSKCIDLPGRYSCACCYGYKAVPNSISEFRFTCQRDPAILSVGNDCCICNTADCKPP
SDGNPAQVCGTDGIEYDNYKQLYELNCAKNGEANIGVGIASYGSCRKEGTTTSTTSTTTS
TTTTTPKPPSVCDSSKICSQAERSTDKPCCNGGNRYKSFCEMRMSMCLKNNQNPDIPTTA
CGNCFPTIKPPTTTPVPTPSESDFEPWGPWKECQPRPSGLPCGTANGVKYRNRLYTGTDT
SLLTSEMLRQQDSCDLHPCPSDTPQPEVPNPCNVEDCPSSDTEQFCGKIVGLDTQPKTYK
SRCHLERNSQCQGLEISKNPNDYYPGICSPGGTRPLSLPCKRGPFKITYAYNSLDSASGT
TCSADNVEIGTCQSGACDEGTNDCCKAVEFEELDSIVTCINMATQRIEKVNKKVYSAIRC
DCVDKDD
Download sequence
Identical sequences V4AA29
XP_009055814.1.39240 jgi|Lotgi1|161733|fgenesh2_pg.C_sca_30000153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]