SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|161802|fgenesh2_pg.C_sca_31000044 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|161802|fgenesh2_pg.C_sca_31000044
Domain Number - Region: 19-108
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00314
Family Pentapeptide repeats 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|161802|fgenesh2_pg.C_sca_31000044
Sequence length 129
Sequence
MVNFNGYIIDVVNFTGLMVNFTGHITAVVNFNGHIIFMVNLNGHIIAMVYFTGHIIDVVN
FSCHMVNFTCHIKAMVNFTGYNTDVVNFTGYIKDVVNFTGYIKDVVNFTGHIIVMLFMIL
PQIVLQRHP
Download sequence
Identical sequences V4AIF2
XP_009055947.1.39240 jgi|Lotgi1|161802|fgenesh2_pg.C_sca_31000044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]