SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|161862|fgenesh2_pg.C_sca_31000104 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|161862|fgenesh2_pg.C_sca_31000104
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.13e-19
Family Fibrinogen C-terminal domain-like 0.00083
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|161862|fgenesh2_pg.C_sca_31000104
Domain Number - Region: 6-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|161862|fgenesh2_pg.C_sca_31000104
Sequence length 253
Sequence
MVNSFYISTCENGTCLCPIGYYGNNCEHIITDCSHGHELNWSHLGQMLSFVKPSLSPEPF
EILCHFDYLGIAHALTRHSSCIPDYYNRTYSEYRQGFGDASTSHWIGLDKFYQMSKERNN
FRLNIYFYTGLSAQCYYNQFSVMDVSDQFKLQVSGFTSHSTEICSDSWTNSVNINNAPFS
TFDNDTTPNDCPNKMAADGSFSALTSPIPKVANFVSNNKSLISSEAQALGSVAKAGVNIS
DAVKNLTNLKNYS
Download sequence
Identical sequences V4AII9
jgi|Lotgi1|161862|fgenesh2_pg.C_sca_31000104 XP_009055995.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]