SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162203|fgenesh2_pg.C_sca_33000015 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162203|fgenesh2_pg.C_sca_33000015
Domain Number 1 Region: 70-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000101
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 20-55
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 139-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162203|fgenesh2_pg.C_sca_33000015
Sequence length 219
Sequence
MSVVYLVLTIASLYPNEAAEWTTWTTWSPCSVSCGDGVIDRARTLIPGPGEPQSDNPITM
TDKYSCYSGICPVDGKWTRWGSWSECSKACGGGERKRFRSCNNPKPTASGEKCKGLNWEK
EDCNKVDCPPTPTNFDMSICNESYFECDSATMCIPIDEQCNELVQCDDGSDEVKCDEVLR
VREGGVRYSTADGNGSGKTEILSVVLGFVFLLTLMLILH
Download sequence
Identical sequences V4BUH6
jgi|Lotgi1|162203|fgenesh2_pg.C_sca_33000015 XP_009056419.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]