SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162896|fgenesh2_pg.C_sca_36000124 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162896|fgenesh2_pg.C_sca_36000124
Domain Number 1 Region: 197-351
Classification Level Classification E-value
Superfamily vWA-like 5.38e-30
Family Integrin A (or I) domain 0.0032
Further Details:      
 
Domain Number 2 Region: 138-196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|162896|fgenesh2_pg.C_sca_36000124
Domain Number - Region: 80-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0275
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162896|fgenesh2_pg.C_sca_36000124
Sequence length 362
Sequence
MRLHCLVAVLVVLVLIDVGEGYYRRYYRYRGGRRYYRYQEADTDNIREITVSKCLKWPIV
KYIVTQFTCPKPDPCAMIDCNCNGKCVDGECKCNTGFHGQFCSETIPDCQNGANLEAEDG
KLKCNCPSGTFGEGCTKDCGPPPQGISSQGAVNTSSAFPNTAFYTCDEGHERVSGKTEIS
CLESGQWESDVLICKPSADPDNFSKMKNAIADFISSSFEVSPTEVNVGFVAFSSDLTETK
FLSSDPNQLLPDIRDLMQEGGSGNFAFGISEAVDDFGARGRPGVSNVLILLSGGKSTGSP
QAIANIAKAAGIDIFTIGIGPGVDRVEMIDIASDPSKARFVDTFDEILEALANVDVINNL
CQ
Download sequence
Identical sequences V4AFS1
jgi|Lotgi1|162896|fgenesh2_pg.C_sca_36000124 XP_009057162.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]