SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162897|fgenesh2_pg.C_sca_36000125 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|162897|fgenesh2_pg.C_sca_36000125
Domain Number - Region: 68-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0041
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 18-69
Classification Level Classification E-value
Superfamily Prion-like 0.00785
Family Prion-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162897|fgenesh2_pg.C_sca_36000125
Sequence length 116
Sequence
MRLHCLVAVLVVLVLIDVGEGYYRRYYRYRGGRRYYRYQEADTDNIREITVSKCLKWPIV
KYIVTQFTCPKPDPCAMIDCNCNGKCVDGECKCNTGFHGQFCSDIFLVNGFGQQAQ
Download sequence
Identical sequences V4A687
jgi|Lotgi1|162897|fgenesh2_pg.C_sca_36000125 XP_009057163.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]