SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|163393|fgenesh2_pg.C_sca_39000127 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|163393|fgenesh2_pg.C_sca_39000127
Domain Number 1 Region: 265-308
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000314
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 128-176
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000068
Family Tachycitin 0.096
Further Details:      
 
Domain Number 3 Region: 197-246
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000133
Family Antifungal peptide scarabaecin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|163393|fgenesh2_pg.C_sca_39000127
Sequence length 314
Sequence
MKTEATCSVVYIYASFESTHPGSALNEFTDIAVHGKPSVLSIIDDKGRPLYVTYEGRKLN
HNNTCYNASFKTLSFKGKPPGADVICRRNGVEKECSRVDLQLSQYNKYLCQENWEHLKNP
CEPLADLNQNSNLYHPVESDSKKFIRCDYLGNMYVNQCPEGHTYDPDTYTCGDQSLAETM
PGRTPFPDHLKNPCLTAADKTGVQFFGHPTDKTKFVQCDFTKHTWVMGCPDKQVWQQIDR
TCTVDFAWHPTSAPVTPDPSIKNPCTTGQEFFPIPHKPDQFIHCANGIMYVQSCAPHMHY
DRVKHVCGTGEPIG
Download sequence
Identical sequences V4A9A8
jgi|Lotgi1|163393|fgenesh2_pg.C_sca_39000127 XP_009057723.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]