SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|164015|fgenesh2_pg.C_sca_43000013 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|164015|fgenesh2_pg.C_sca_43000013
Domain Number 1 Region: 497-803
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-72
Family Eukaryotic proteases 0.00072
Further Details:      
 
Domain Number 2 Region: 131-194
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 263-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 227-269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 322-380
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000681
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 6 Region: 386-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|164015|fgenesh2_pg.C_sca_43000013
Domain Number - Region: 100-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|164015|fgenesh2_pg.C_sca_43000013
Sequence length 804
Sequence
MAGIIGCIVVFTATFLLPSLVVTSSCHPRIVTCRCGKTTVDIHIKRCMKITAWGATCKPC
EKYRKSQLCAKYRHCVHCDADGCLKCKKGWYGTFCREECRCENGGSCDHHGDCQCLPGYI
GGYCQTKILKDCGSPNIPVYGEVILTNTTEGSIASFKCPPNFLLIGQVNQTCLDTGQWSG
KAPVCEYSCPVPKVSSHLVVQPEPVKHMSDDYVISTYHVLYNVELIRQVRFSCEEDYEIQ
GRQLLYCLPDGTWDSSPPICVRKCKPPPQVRDGEVLKGNLRSLEGDTIEYRCHDNFRIED
HSTLTCMNGSWDSTPPRCVPKIQCDQLEAENGHITYSDNDRMVGSEAILRCYSGYIKSSS
DDYKVCGQDGQWKGEKFECVEKEEEVMLCDEHDGPEHGGVDEWSESHYEYICEEGYFISG
ETQNYCIDGEWIHDIPKCVQRTTCKAVDKPDGCSVCFGDDCSKLRHASDCLMTAGDIVLP
EDRFMVGTVMEFRYDRMLFQLFGSRRRVCQSDGVWSGRTTTCVPRCGIHSFTRKIGVTPR
IRMGLPTSDGKWPWQVGIIWDQDNLRLQCGGSLISEDMVLTAAHCVESASGVKKAEEIMV
HVGTVSLTGKHRQLVKVKRIIKHEDYFNHGSFDSDIALIQLHDKLTISTTIRPVCLPDPL
DSEDYVINDTNLDHMVPMIRNLTGVEGVVIGWGLTENGSSPDILKMTNVKIADQNECIEF
YERSSTNMMNITDKMLCAVGSNPTKADACSGDSGGPLLVEDDSGRWTVVGIVSFGLFNCS
MSVEERYGFYTRVEKFLPWIHHHL
Download sequence
Identical sequences V4A1B0
jgi|Lotgi1|164015|fgenesh2_pg.C_sca_43000013 XP_009058759.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]