SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|164173|fgenesh2_pg.C_sca_44000015 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|164173|fgenesh2_pg.C_sca_44000015
Domain Number 1 Region: 58-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-20
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 2 Region: 156-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|164173|fgenesh2_pg.C_sca_44000015
Sequence length 385
Sequence
MEIWKSLSFVYFFLLAIQQVFTKRSLPKYYMSELCGQTLQLAHTPVPAGRVELVRRGDYR
DNMNCVWTIIAPSKHFLMVMFKDVDIDKRFFKCNDYLQIYDNDKPSGNFLSGVSKLCGEN
HPRYPIYTNKNAMTLRFVSDSRHDDDGFDLYFNVYHQGQCNTSEFKCDNGHCIDKSLQCN
GYDNCGDNSDFCPNHTSSLIGIIVAVIFIVVVIVVIVYICRRKRQKRGRSFKQNNDVPMT
TTFPQSQPQTTYQPPQGQGYPPQGYPPQGQGYPPQGQGYPPQGQGYPPQGQSYPPQGQGY
PPQGQGYPPQGQGYPPQGQGYPQYHGYGSSGGPEGYSQGAQYPQPGQYASQYPPPQGPEG
NIPSGAPPPYPGPPKDENEFSKVPL
Download sequence
Identical sequences V4A5G2
jgi|Lotgi1|164173|fgenesh2_pg.C_sca_44000015 XP_009058927.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]