SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|164635|fgenesh2_pg.C_sca_46000112 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|164635|fgenesh2_pg.C_sca_46000112
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000851
Family Fucose binding lectin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|164635|fgenesh2_pg.C_sca_46000112
Sequence length 240
Sequence
MQDNRITLGIFLFGFGLLLNFYTVTCMTWNVARGKPAYPSSGINAINAVDGDPSTCFRTK
DDGSDSEVTLTIDLKQIYKIYGIAITTSNLGLPGEFKNFQLQMLNLPGNSRPMCYRENTT
VPDSTHVLYICDLDAIGNMLYINPMNSSNRGILTVCEVEVLARPVEFGLMCRESGFSFNE
TPTHETSLMLSAVGCAVMCKQIGCDAYISKNENAVNVCMLYSGRKFVLNGNVNSNFYLNC
Download sequence
Identical sequences V3ZZX6
XP_009059409.1.39240 jgi|Lotgi1|164635|fgenesh2_pg.C_sca_46000112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]