SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|164938|fgenesh2_pg.C_sca_48000070 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|164938|fgenesh2_pg.C_sca_48000070
Domain Number 1 Region: 1242-1261,1866-2041
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-25
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 2 Region: 2038-2244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-16
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 3 Region: 2241-2414
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.62e-16
Family Laminin G-like module 0.038
Further Details:      
 
Domain Number 4 Region: 2666-2843
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000187
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 5 Region: 2467-2637
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000158
Family Laminin G-like module 0.034
Further Details:      
 
Domain Number 6 Region: 922-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000406
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 7 Region: 495-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 1027-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 9 Region: 1143-1185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000193
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 1074-1117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 78-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 12 Region: 588-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Laminin-type module 0.068
Further Details:      
 
Domain Number 13 Region: 216-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 14 Region: 26-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.095
Further Details:      
 
Domain Number 15 Region: 541-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 16 Region: 181-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 17 Region: 636-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|164938|fgenesh2_pg.C_sca_48000070
Domain Number - Region: 983-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 270-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 886-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family EGF-type module 0.085
Further Details:      
 
Domain Number - Region: 1785-1865
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0863
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|164938|fgenesh2_pg.C_sca_48000070
Sequence length 2844
Sequence
MPLVFNIAGNTYQHYAIKELEVLADCICNGQQTGCELNNDTMEYNCICGGNTKGQFCESC
QPLFNQQPFKYGVPCDTCNCNQHASECFYDKGVAALKQSTDGNGTKNGGGVCVNCLHHTT
GVNCEKCSTNYFRPIDKQQTEEAACVPCECSMSGSTVNPVSSIVADCIMNNDNSLEAGQA
PGDCFCKKNVEGTKCTQCKKEYFNLRADNSDGCQPCDCEVGGTIGSNKTCENDSTGQCNC
KQNVQNRQCDECKDGFYNLNPNNAEGCTACGCDPGGSQSMTCDKTFGKCPCRTNIDAMKC
DSPSDLHYYPDVHFISAEFEYGTGDASLSRGPQYGGFKGDGYADLKSGNLVGVNLAIPGG
TQLTGEYILIIRYTTTIASTGQLEVKSLGTSPLMINFPVCSSGWCSVNTLASRNFTLQPA
VYTVTIRVLGDMFLDQIVAVPVEFVNPLSSLVDPSFSTVCNVLENSIGTDDAVQKLCKAS
IFSMTTYYLNGARSCDCDKDGSMSMECEVYSGTCRCKPGVGGRKCDECLPGFYDLSNTGC
KACECKGSNSVCDKGTGQCVCPPNTIGRICDTCAVYHWNWSSAGCQPCGCDVTGSISAGC
DQKTGVCTCKLGVEGEKCTQCKDEFKLFSVSGCSSCLCSTVGSNSTVCAKTTGQCICKEN
VAGMICDQCSATSFYLDKANDAGCLDCVCMGITQSCSSSTQRLSRTSTLLTTNLGGKLQA
SIQLSDGQGALVNNTINIISGDTMYLSVTQEGTTPQYWMAPGDLKGNLLHLYGMNIDTDI
QYTSTGSGTASPAQAIMVGRKGRYVHDFGAPGADNKTQLSVKVDEKSWLKDGTTALNRSD
FILAISSVDYILLPASFLNGPHTSQLHRLVYYKKESTGSVNLMMENCQCGTGYIGSSCEE
CAPGYRRDKVGEKGYLGVCVPCECNNHATECNPDTGDCINCQHQTTGSKCEMCKAGYYGD
ATLGTPSDCNECMCYPPRVVNSTCEQESGSIKCLFCETGYVGNLCDECDTFYYGNPNILN
TGKCTRCNCNGNSDSCDKNTGKCIDCKSQTVGDHCERCQDGFFGNATSQSCANCACSPGG
SSSSVCDTSTGQCPCYTGVGTRQCSKCKTGFWGYSDRRSFGSYSKNFSLFLPCPFNLQCC
VPCNCIEAGSTTLQCNDADGKCTCKPNVQGDKCDTCEDGYFGLPTQPCEVNLLSVDRKYS
KKLSCFPCKMDTKRFDEGPAACNCNVTGTVTGQMTCNKTSGQCDCKSGVSGRQCNECMKF
YSGFSEAGCTACGECEQSLGNDTLKQIERYAELWSGTQKVSGIQEQDMVLRNLQSELNMT
LGNLGLGGGSSQTSVTANLSSLTTSSNTEIDKLMSQVTRLEKGTEQYKNDCTAANNKIVV
MVTKSNMVLSNASAVKQKSSNYDLTLTTWDTTATQILNQGSSDGSGISLDFSAEKQKADA
VLAKIKDVTRVGSMDTKVSQQSGLIDNIKTQSSTVETDIQSGAKSVLDKEQELVALLAKE
TDIRTKQTTARRYKTNTEENVLEAGKLISKADNETKTAQTDLDSGKAAVLKHDAIYNGVA
MTAVADDLKPLPTGYDNFVNGAAELNRTLGPAETARDAEVQTVAAAEITARSLMNAAELL
NQTFLEVKGRGDNAVDAINSYEKVTPLLNDALNLSGNANKTIEETRTMMAGISVMNLETL
ANTAKLASEQMRTEFTSLNYGTEVLKSRIESANASLVETVNDWNKVETLINQMTASANQL
KTTSEANTVNQVVSEGDVAVSQAEELLTRLTATSDAHVSNLNTRESQINTLKDLSATGNQ
LITNTEQSLTTHNTNIDTMNRQIEHVNGLKTETQTLKESLESKVTSIKAKIATALSKLKT
LKQPIHFNGSSPISVTNPITTSDQNYNDISLEFRKESGVTNGLIFFTENTNSGAELSLEL
VAGKVTFDYNTNLDPVTIENPAVICDGCWAKIIASRYGNSGHLTVKVLSTGGLATMAGRG
KSSSQNLLVNSPLMFGGLPSTYQTTKVRTRNFLGCVQKADFNGNDVNLWQEAIDLNWEPK
CCRQPLQTKPDNLSPGVSIDGSGYLLLSQSTLNLAARSSLYLTIKFRTFNPNAAILLVIS
SDKLTKYTLFLQDGNVNFEYGTSANMFTAKSQKKYNTGEWVQVIAQFTANQFELETKIDG
VTSPTPDKIIKGALPVSLVGLDSQDIIIGVNKNPNDVDYSRSEKNFAGCLKELKFGSGVD
SLTELSLSSNPIKSLGVSTSGCYNTILNGMRFTSLTSTAELNVGAATLAALQQIEFTLIT
SEPKSILLYIQEAVSATRKLYISLFHGNIIVIYQENNQQIFEVMTTGLYLSDGQQHNIKL
QILQPKAKLTVGNSVLESSQDLVASPLSFTNTPTLHVGGVPGTITLPASFPARTSLIGSI
RELKVNSVLLDPFAAGVIVKEDGLDLSGVATPSGFIPPPPFTTTTPPVTIPPPSCATVTV
PSYLEASAGVWFTGADNENLNYDRTNIPANMFRTSFMIFITFQSFSPNGILYYMANQNTN
QNEYFMVYLRDGYIHTKFKGKLEATGEVIEYDFKSDLRYNDGVKYQVDILRLNNFLALVE
KTRKDYANNAIETTQASTLDINTNVYIGGINQAVGRAILPITENVNFVGAVYNVELKMDP
VSYTFDLRNATGQEATGLIYKSAVYGVSLTGVNSYIKLENPLNGNELSFTLGYRSIQTTV
NLLTIYETSGKFVVLDLLNGKIRVLLASSTSGGQSFISVSEQQINVCDNERHNITVAIGQ
LGVGIQLDTFINQVFPYPMGLNPPSLRNRPVYIGGLEDTSLVFPDPVSKESLRGCVERFV
LQGVEYDLTQQIKSSSGLTYACPV
Download sequence
Identical sequences V3ZEQ7
jgi|Lotgi1|164938|fgenesh2_pg.C_sca_48000070 XP_009059688.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]