SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|165458|fgenesh2_pg.C_sca_51000138 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|165458|fgenesh2_pg.C_sca_51000138
Domain Number - Region: 181-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|165458|fgenesh2_pg.C_sca_51000138
Sequence length 703
Sequence
MMMESSINSATILPPYEEEFEPVDNLHWSPETANSIYLFWINQLQASMLIVQYGGRDKKH
TQQIVGSFLIGLNAPKHAICRGRSDSRACNENFPNSHIVLPDKTTVKNSVGKCIRPNVCE
CKQEGFYSAGSFCNICSPINNCDLEYCTTKTNQRCRRCEGLVADKSWYRAYIISTDKRLC
IKSCSWRPDSRCYPGTCRDELFSNCYCSVGFTGTHCNRITAIPDILYNQVTLSADNGETV
DAPDGRNGVKTQTVSCTTIRKDNPNQGLLDCTKTIKRTFPVPFQHLEQLSFKITTTIGGF
VKIKNLERNVYNTYYYTPNSLSRAFEIKFDNVPPYHCQPVDNCKLTMLTDIDITKKVENT
VYWDGWIGEDSGIAKYELEIFSMKSVGNELIIDKRIFDTETTLKSQQFNLTVPGVYSVIL
AAVDKAGNIRLARRCLIFDDNSQENRYINTKHHNGKYLAGIQDYHGLDPEYDDHYGIRTK
KHIDNVQGIVRYETYYGIDDQGGSTIQPTDTDFTTTGNLNQSITISPTLQDGDTVKFYIR
AYDIVDFYLEESTTVYFDMSPPVIKDLWLTKGDKVDLAVHGFQDFDKLVIEWIAYDLHSG
LETVEWKLYDNFTGDVILHGSQHIPVQGEAQTRKECEEKYQNSPRGSCYCYCTPAVGCYL
QHFQVKPGVSLDEGTGLIQGKHQGVHDYDYYIEVYVMNNAKLY
Download sequence
Identical sequences V3ZWB0
XP_009060720.1.39240 jgi|Lotgi1|165458|fgenesh2_pg.C_sca_51000138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]