SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|165684|fgenesh2_pg.C_sca_53000027 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|165684|fgenesh2_pg.C_sca_53000027
Domain Number 1 Region: 149-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00006
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|165684|fgenesh2_pg.C_sca_53000027
Domain Number - Region: 62-121
Classification Level Classification E-value
Superfamily L domain-like 0.00221
Family Internalin LRR domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|165684|fgenesh2_pg.C_sca_53000027
Sequence length 226
Sequence
MLFSVIIVVFTSLLNSSIVSSEDTDIDNICYKACNNESKGFLEEHCTGVDLTLNNSHCCF
NTSSSRPRIIGIDLRGCDISTIKALDEVIESLIVISLEDNPIKSDLNTDFNGLRNAVYLS
LPPSLDCPGDNEAWESIEKSNTSTICHNQIDTCLHFNISCPANSECKNTGPGTFECDCLT
GYHGYKCLNKGKFPAAYYGIGFAVTTVGLSTILWILQRRHVIKRTD
Download sequence
Identical sequences V4A4Q7
jgi|Lotgi1|165684|fgenesh2_pg.C_sca_53000027 XP_009060971.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]